DPCstruct | MC61072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 167 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3JYV0 | 5-170 | EIAEYLMNKDNVPMLGCENAWIAAGSLMAAIKNNGSVKVTDEQIVEALIRTKRQAIGGYCGLTGVCGIAPAIGACFSVILGAACPKD… |
| A0A7C4SM09 | 59-231 | DPIIMFETVIDELRRLWNLSPRMPVSGPWHHAVVPGVLIASLRNNGYPFTDEDVEEALKRGALVPAAACGFLGVCGVAVGLGIAVSV… |
| T0E1X0 | 2-116 | None |
| A0A1V1P6E0 | 90-267 | None |
| A0A7C7RE21 | 537-720 | None |
| A0A7V6LF50 | 142-339 | None |
| A0A3R8JQ91 | 24-184 | None |
| A0A1M5XM61 | 52-236 | None |
| A0A315XBW7 | 123-303 | None |
| A0A1C3FC52 | 11-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.