DPCstruct | MC61062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379WN02 | 19-96 | ERRSVLERESQLYGSFDGAMKFIKGDAIAGIIIIFVNFIGGISVGMTRHGMDLSSALSTYTMLTIGDGLVAQIPALLI |
| A0A7V8A9H8 | 73-157 | ESNFFGAMDGASKFVRGDAIAGLLITAINMIGGIIIGVAQNGLGFAEAGATYTQLTVGDGLVSQIPALVISVAAGLLVSKAGVEE |
| A0A800C6J1 | 46-124 | None |
| A0A080JBT5 | 56-141 | None |
| A0A377KBB7 | 25-103 | None |
| A0A381H8J3 | 93-176 | None |
| T0DUK7 | 24-115 | None |
| A0A511TIC5 | 76-172 | None |
| A0A2X1NI88 | 594-681 | None |
| A0A3M5E3C2 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.