DPCstruct | MC6106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 224 ± 25 aa |
| Standard deviation of domain lengths | 25.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8WP63 | 238-444 | RLDSRLGQKVDQLYLSWDRILVDMDIREGESLTLHHKYKTVTVQIQDPREKQGAHSESEAWVQVSKATFDALEDKLGMSVARKPAGK… |
| A0A2A4ND13 | 1-229 | MNKLLKILGPILMLLFIVSCGGRDFVKSPVDEYITQFVDEQNFAIILEDMDVEGTFFKTYKHRYQVILEDSDGKPLDTKSEWKEVGE… |
| A0A353WZR9 | 1-214 | None |
| I4AIU3 | 341-518 | None |
| A0A800K3M7 | 218-467 | None |
| A0A349DSN8 | 261-486 | None |
| A0A2A4NKV9 | 9-208 | None |
| A0A7C8HWS9 | 47-286 | None |
| A0A7J5AAS7 | 2-274 | None |
| A0A2E9GAT9 | 141-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.