DPCstruct | MC6104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 319 ± 56 aa |
| Standard deviation of domain lengths | 55.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 19.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6V2H1 | 61-390 | LDDHSIPDTLQAYLHEQHEKSVAYVRHQVAAYRAQVHAFEAALATAPRVAMEDIVRRAKSAVQSRVGAVEAAFQKQFLAWEGLKDQH… |
| A0A7J8IFQ7 | 64-344 | ENIGKKILEYQSQTNEYHNSCLIELRAQMRRFEELLPQVCWLVMENFKEQHWKKFCASIKEIRKQFWDYKKQLETKRDENAQSLHPT… |
| A0A6P8GPT9 | 7-248 | None |
| A0A3P4RMV7 | 912-1192 | None |
| A0A1S8VEJ2 | 172-540 | None |
| A0A7S2STV2 | 2-265 | None |
| A0A7J6Q5F6 | 264-599 | None |
| A0A1Q9E0K2 | 13-331 | None |
| F1LXD9 | 1356-1636 | None |
| B3RNU0 | 809-1143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.