DPCstruct | MC61031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2NQ41 | 10-96 | RVEESDRLSFLPYLFGADFLYAEMQVYDYANCYLPEYNGGFWHFIRLPDGGGYMMPDVGPVLLVNDDNGFDRTVSSDVAGIILTSRV |
| A0A6L6F7B3 | 21-116 | IVITAIEVKNEQVRLKFLPSKLGRYCIAFENAIYNWMDRNAIAYNGGYWDFYTLSNGSFFLQPTKGYMITSPNGFMDDASAQEAGII… |
| V4NTJ2 | 220-318 | None |
| A0A482M2V1 | 2-94 | None |
| A0A6D0R4M7 | 20-120 | None |
| A0A1H3QT45 | 2-104 | None |
| A0A857EW82 | 60-171 | None |
| A0A1W6KFF7 | 9-115 | None |
| A0A811BQV6 | 114-226 | None |
| I6FAE0 | 5-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.