DPCstruct | MC61030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A193QLS6 | 28-150 | TLTAHRYRCEQTNFDTFLSYTQIDAWSGHPQFHQMISDQIARQEANDRLMVGFNGTSRAAKSDRAKHPLLQDTKKGWLQHLREDAPQ… |
| A0A7R8WU59 | 193-329 | ELKGDEYHCMQTNFDTHLNYAVLDSWAHLTRDDFRRMYSRAVLKRMALDRIMIGWNGSSAAETTDRAANPLLQDVNVGWLEKVRLKA… |
| A0A447PAT8 | 1-142 | None |
| A0A376ZJL7 | 39-180 | None |
| A0A1W9F793 | 115-215 | None |
| A0A607GY60 | 5-114 | None |
| A0A381GKB3 | 94-195 | None |
| A0A808U4G5 | 95-224 | None |
| A0A379KEC6 | 24-135 | None |
| A0A3P8M1R3 | 17-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.