DPCstruct | MC6103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1324 |
|---|---|
| Mean domain length (aa) | 95 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 15.65 |
| Pfam Score | 96.05 |
| Assigned Pfam label(s) | PF05019- CL0125- CL0059- CL0168- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4B2N7 | 2-73 | EPDTNRPEEDYTSFDLSVPDPDACANACREEEKCMAYTYVKPGVQGENARCWLKTAIPDARPDECCISGVIR |
| A0A3L6V0R4 | 175-259 | STQALNPTDDLSTCGTLEDNTHYVGGDLASFNLTTVESCCAECKKTPGCKVFVWYNLNGGFCRLKDTQGPKVAVDGAIAGVLPAP |
| A0A0N5CU48 | 32-117 | None |
| A0A0N5CMM8 | 399-486 | None |
| A0A818ZU17 | 14-128 | None |
| A0A818VUA9 | 178-255 | None |
| A0A7R8XJM1 | 57-127 | None |
| A0A0D8XPW4 | 236-333 | None |
| A0A0D8XNV8 | 225-332 | None |
| A0A0D8XEJ7 | 59-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.