DPCstruct | MC61024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 50 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9GB83 | 21-74 | KESTPIKDCICNEILIGSKSPLQCKLFRKTCNLQNPVGVCMASREGTCAIYYKY |
| A0A7C4KTH3 | 9-56 | CRCGQVLVGAVRPPECPLFGTACDPAHPVGPCMVSSEGTCAAYHRYGG |
| A0A7V8VHG1 | 3-42 | None |
| N6X2T9 | 10-59 | None |
| A0A7W0UAB9 | 1-35 | None |
| A0A7C4MQX2 | 42-94 | None |
| A0A1F2VQY5 | 138-191 | None |
| Q1NM89 | 3-46 | None |
| A0A6A9T187 | 442-495 | None |
| A0A176YIY8 | 71-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.