DPCstruct | MC61020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 235 |
|---|---|
| Mean domain length (aa) | 294 ± 64 aa |
| Standard deviation of domain lengths | 64.29 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.05 |
| Pfam Score | 99.73 |
| Assigned Pfam label(s) | CL0062- CL0224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8D5I3 | 3-219 | PHCAILDPTATFSLPPRQTANGVVDAFIHILEQYLTYPVNALVQDEYAEGLLRILIEEGPKALTSPQDYDIRANIMWTASQALNGIL… |
| A0A7C4DHH8 | 105-392 | RWFARRLAMGGSAEELFDARLNVDDKPLSQVELAEAKIPDIELVVGIGGGMVMDMAKYVTWKRGLPLLLSPSIASVDACVTNTIAVR… |
| A0A7V3H3U8 | 26-369 | None |
| A0A538A2J7 | 177-465 | None |
| A0A484X867 | 22-314 | None |
| A0A061RCK2 | 27-291 | None |
| A0A850R0G3 | 284-675 | None |
| A0A7V9L279 | 113-441 | None |
| A0A841G1L2 | 8-329 | None |
| A0A177VK47 | 11-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.