DPCstruct | MC6102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 65.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9T108 | 9-127 | ARQLCVHPEILDSEDDNDFEEPSKGNDEGEDTFMRSYSDILNEELNTTTLGKSFVRAKEQTTQQDEETSSNTTAAMDEDFTPVDADV… |
| A0A3L6UQW6 | 5-118 | MEILKSGNVGDNLHESPRSEQDTNVDDYFFESEDDEVDMDAMMAEMDSELTESKMAKSFLSQPHQPGPPIEHDGDNVKPVDVDFNLV… |
| A0A1A7YPZ4 | 521-648 | None |
| A0A6H5H477 | 283-389 | None |
| A0A7J7DM08 | 201-325 | None |
| A0A7S0LJ36 | 10-133 | None |
| A0A4Y2MD56 | 361-477 | None |
| A0A3S3MI17 | 170-301 | None |
| A0A7S0DQ79 | 66-193 | None |
| A0A811R5G8 | 259-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.