DPCstruct | MC61015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 213 ± 25 aa |
| Standard deviation of domain lengths | 25.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7R6W3 | 51-268 | NVSPYFGKVKISGTKLKTSSSPSLITLSTGLKKEEEINITKWSIRGKKGSFVIPRAIERYRHLYEQEPEDIVIEYGDKVYLSGAPGP… |
| A0A837IJQ8 | 2-191 | SAEYILLENIDYENKQKITISGFKLQNRDKLTATIGQDENGASITLDYGERTIIITGESPLGYNFKINKCSGYFNQRAAISPQIYAI… |
| A0A0S7WYY2 | 88-315 | None |
| A0A2M7UUY7 | 168-385 | None |
| A0A0G1VGK4 | 41-245 | None |
| A0A3M1DCE5 | 223-429 | None |
| A0A1G2LD71 | 61-306 | None |
| A0A1F6DBB3 | 1-174 | None |
| A0A1G2MTF4 | 98-360 | None |
| A0A1F5BVH8 | 265-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.