DPCstruct | MC61013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 131 ± 19 aa |
| Standard deviation of domain lengths | 18.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2X1B0 | 1-118 | MDQDGFMPLLQTAWRNARLRRGGHVDFGLDIFVHIEKTKRVPTATLHRATENRVQQVLPRVQEALQAANVPFGPATLRYAATAQARL… |
| H3GL09 | 6-143 | IIYYKPTNNAYQKDYQVLCNDSSTMQVQLDTAWRKARLRSRGQAGFELELYVYEPKPADQATSLRRATAARVQEQMPRVADVLCEQG… |
| A0A2P4YVJ9 | 1-119 | None |
| W4GV64 | 72-175 | None |
| A0A6G0RYY6 | 5-105 | None |
| A0A662X106 | 163-295 | None |
| A0A6A3QSR3 | 74-238 | None |
| W2XZI5 | 1-102 | None |
| A0A6A3RYC7 | 5-125 | None |
| A0A833TB69 | 108-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.