DPCstruct | MC61011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 102 ± 19 aa |
| Standard deviation of domain lengths | 19.46 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1XD43 | 15-119 | PTPEAMANIKSAIKRVQIAERNRLRNRTYNSAVRTLMRKYFAAVEQYAANPSDEALQEVQQRMSATTSKIDKAVKVGVLHRNNAARK… |
| A0A1F4T547 | 14-93 | RGIKNVRKAQIRTDRNLIEKKKLKLAIKTAKLAIAKKTPEMANLVTTAVSIIDKAAERKLIYRTKAARMKSRLMLALNKA |
| A0A354CWS2 | 48-133 | None |
| A0A3A4Z962 | 18-112 | None |
| A0A3B8QBT3 | 27-118 | None |
| A3DE92 | 23-111 | None |
| A0A6N4ARY0 | 1-95 | None |
| A0A453FDD6 | 1-141 | None |
| A0A7S0GNI8 | 71-204 | None |
| A0A2D5IRJ7 | 91-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.