DPCstruct | MC61010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1WM65 | 25-128 | NPDYYYHARFWSKFYVLNFGIGVASGIPMEFQFGTNWAPLSEAIGNFFGSVIGFEASWAFMLEAAFLGIMVFGWERVNPIIHFVSTI… |
| A0A840TAK0 | 1-112 | MDSVEISRFLTGMTLAVHIIFATIGVGMPLMFAIAEFLGIKNKDPKYIALAQRWSKGYTITVAVGVVTGTMIGLQLSLIWPTFMKMG… |
| A0A0B0I8K2 | 10-137 | None |
| A0A6D2GCK1 | 2-117 | None |
| A0A0K0GJN5 | 3-123 | None |
| A0A6M1HXG6 | 4-135 | None |
| S2Z5D5 | 1-131 | None |
| A0A4Y8LZ29 | 6-136 | None |
| A0A499VB84 | 11-140 | None |
| A0A378LQ48 | 4-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.