DPCstruct | MC61005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8IGA9 | 1-99 | MAAYQKAKSNKLWRQHSYAMENEYEYFAVAAESFFHDIIRKDAKSTGGMNICKNQRICSDEMKARQFLRRHDPGIFYCLSYAFTDDR… |
| A0A2C9LEB1 | 57-163 | QGLSGADKAAVHAAYTAARARQTWTLSSYAMQNEQEYFAEAATVYFGINYSNINSGGMNICAPGAFCSGEMADRYHLYQTDTALYNI… |
| A0A6J8B2J2 | 204-298 | None |
| A0A8B6H4J8 | 175-279 | None |
| K1R7E1 | 427-542 | None |
| A0A6J8BQ25 | 621-732 | None |
| A0A8B6GBZ4 | 97-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.