DPCstruct | MC61000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7LBM8 | 1-104 | MVQLIMEDVEDMGFLRQHIHTLDREFDFWMTNHTIEIDYNGQKHKLARYNDMSQGPRPESYKEDIDVAKHFDKHEDREELYAELKAA… |
| A0A7R9FTG1 | 51-148 | AKKYYDHTGDFDFIKRNLDLLDREFKFWEENRLVEVKKDTNTHYVYRYIVNVTGPRPESYKEDVATVGGLSKTDQDNLHVSIKSACE… |
| A0A0A9Q6Y7 | 1-107 | None |
| A0A0N1ITL5 | 188-287 | None |
| A0A1I7WJK5 | 31-121 | None |
| A0A2U1LY60 | 166-279 | None |
| S7Q4A9 | 20-137 | None |
| A0A0R3QFB4 | 64-174 | None |
| A0A077ZMV3 | 124-214 | None |
| A0A397JK76 | 84-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.