DPCstruct | MC6100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0RYI0 | 2-62 | RRKCPKCGSKKVVEIMYGLPPMGDQWKKDLDEGKFVLGGCCVTNHDPKWYCKDCSLEFYKL |
| A0A1A1ZDM2 | 11-66 | DLRFALNPRCPSCSAQRTMSTMYGMPAGPVEQPWIAAMGCCVQPWEWCCAECGHEW |
| L7KR74 | 218-282 | None |
| A0A397LMY3 | 228-296 | None |
| A0A1N7HB14 | 240-294 | None |
| A0A842RXY7 | 27-88 | None |
| A0A1X7JKY0 | 2-60 | None |
| A0A385SQ14 | 144-207 | None |
| A0A6I2ZCA3 | 2-57 | None |
| B8FE97 | 7-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.