DPCstruct | MC610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 206 ± 44 aa |
| Standard deviation of domain lengths | 43.83 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 88.46 |
| Assigned Pfam label(s) | CL0023- PF04265- CL0072- PF04263- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536P907 | 140-348 | LRGVRAVVVAHGDPEASDRAQCLRADLIVAADGGALVCERWGILPQVVVGDMDSLGREGTERLRARGARIEAYPRVKDQTDLELAIA… |
| T0U6K1 | 2-127 | AIEHFPNAKIDIIGATGGRIDHFLANLWIVLEKRFQPFAHNISLLDKQNVIRFFLPGKYSIRKEKGMKYLAYCCLTPIDNLSLMESK… |
| A0A7R9YA71 | 1-120 | None |
| A0A7R9KV95 | 6-225 | None |
| B9EW12 | 32-258 | None |
| A0A350J076 | 19-199 | None |
| A0A357ZBW6 | 7-149 | None |
| A0A3P6ZXP4 | 15-150 | None |
| A0A226ES04 | 437-661 | None |
| A0A1F9QXQ1 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.