DPCstruct | MC61
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2N8J7 | 66-146 | GGVGEIHVPQNYTCDIVLKEVTVVKDSDLTGNASLGLALDNPRNRLLVAVADMFGNRYSALAAYDLSTWKRLFLTKLSGSG |
| A0A164U873 | 1-78 | MEGGLGIIPISNATTTSVLPEIPVVKDADLFGNATLGFTIDSKRIRVVVVLSDLLGNKYSAVAAYDLSDWSRLFLTQL |
| A0A178UR94 | 5-86 | None |
| A0A498ISY9 | 1-84 | None |
| A0A178UP67 | 4-80 | None |
| Q84X25 | 70-157 | None |
| A0A816IU73 | 1-94 | None |
| A0A6A3CFX6 | 30-112 | None |
| B9F7Y3 | 83-170 | None |
| A0A1R3H179 | 64-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.