DPCstruct | MC60996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 12.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5CM55 | 4-110 | AEQYWSPHTSDHLPFDANLISIIYENELLENLFMQKKVILLEFSQYFEHYLWPNFCAEQANNHYIMSIVIMLNEKFRERIPVWRSII… |
| A0A0L7L2X3 | 16-157 | MSSKKLKMKTDTAPPPTDKPKIPLPTLSQINADRITQLANQYWSPATKEHHLPYNAAIVESIYQAEILGSNFSVRRIMMLEFSQYLE… |
| L8HF13 | 5-126 | None |
| A0A5K4F2S2 | 1-117 | None |
| A0A2C5Z108 | 12-146 | None |
| A0A0D2MVS1 | 37-177 | None |
| A0A3P6C9V1 | 18-157 | None |
| A0A4Z2E104 | 1-99 | None |
| A0A7J6QXD6 | 103-250 | None |
| A0A5N5SXG3 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.