DPCstruct | MC60991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7KPT8 | 1-67 | MDQDTAKKLLVDGGTFIFLGVPEETVFGIDMQCWNTEEDFRGIKMIPPGLHYIFYSGVSKGTGDVSP |
| A0A3S5C5W3 | 10-77 | GVLILRDVPVNTEVGIDLKSWNVGPKFMGLKDIPLGIHFVYFSSVDKSMMSGLRVGFFHVFDKPGFAV |
| A0A7J0EK32 | 694-757 | None |
| A0A433Q4Q4 | 39-104 | None |
| A0A7J6TXI5 | 3-82 | None |
| A0A3M0J3N9 | 3-82 | None |
| A0A1S3VVS6 | 1-79 | None |
| A0A1D6EFG9 | 2-89 | None |
| A0A0V1D4T6 | 35-109 | None |
| A0A7R8CGQ3 | 16-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.