DPCstruct | MC6098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 214 ± 26 aa |
| Standard deviation of domain lengths | 25.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5WYL8 | 78-285 | DVDYLTKLGLMKGHMIVAKELLDVQKPDQALPHIEHPVEEIYADVEGQLKERNVKEFKQVLMDLQQLVKSKPNDPSITAKYNDAIAG… |
| A0RV41 | 16-231 | LPLLLAGGMAASSAESWGDELEFSSAVEESLSHYHAFELNLDAGNTELAAAHAAHPALELYPVMSPHLQAYPELAERLRLALLDVPS… |
| A0A1W6ZUU3 | 99-324 | None |
| A0A2H9RQX7 | 165-403 | None |
| A0A6L7VR81 | 53-267 | None |
| A0A7J4RT98 | 1-196 | None |
| A0A7C1RGB4 | 2-186 | None |
| A0A1Z8QGD8 | 38-235 | None |
| A0A1Z8Z3I1 | 60-258 | None |
| A9A295 | 12-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.