DPCstruct | MC60979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T3EF40 | 133-253 | NNIKKIILDKYEKNLSFIESKKAISDTIQKGTILYSDWGYEQTNINFYLVLERKNSKLILQEIGQTRTYERQDSGTCIANPEIKKGE… |
| A0A373ZNT3 | 26-120 | RRSLRVGDILYASWGWEQTNIDFYQVIAIRGSAVDLRQLDQRTTEDGYMCGTTVPLPDVFKGKTHTHRLSKNYIRIDSYRTAWKWGG… |
| A0A446AYP6 | 129-238 | None |
| A0A1I3V3M8 | 20-132 | None |
| M0DUX2 | 38-140 | None |
| A0A351TN38 | 1-129 | None |
| A0A077NNR3 | 8-125 | None |
| A0A6N6NPA7 | 95-219 | None |
| A0A2R4MJ31 | 82-191 | None |
| A0A2S9WZ81 | 69-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.