DPCstruct | MC6097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 190 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A319FNZ9 | 7-183 | AAYEEEMRKMAEVKRAYESLEDGQRGPRISLANTRFELYCMEYFDYFYDSDCVYDQLIKHVEFQHHHGNRKAGLPPAGLRRVDGKVH… |
| A0A6A6K0X5 | 543-737 | TPKKEGILRISRETDNLSIKKAVAASGGDTAALQEAAERGMQAEKFLKHAIRARIPVPIGQLEGMWTLYCPQYSAHHYDRYGYGART… |
| A0A316ZPL7 | 333-508 | None |
| A0A2H3S5I4 | 20-190 | None |
| A0A2U3DQL0 | 176-392 | None |
| W7EB13 | 170-406 | None |
| A0A0D2YB23 | 4-170 | None |
| A0A6A6APK8 | 24-211 | None |
| A0A6G1IZ32 | 102-284 | None |
| A0A1L7U080 | 71-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.