DPCstruct | MC60964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 52 ± 2 aa |
| Standard deviation of domain lengths | 2.39 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 76.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653D296 | 101-151 | VLGKFAVIMADPPWDIHMELPYGTMSDDEMRQLGIPMLQDEGLIFLWVTGR |
| A0A2H5NGR6 | 469-519 | ILGQFGVIMADPPWDIHMELPYGTMADDEMRNLNVPALQTDGLIFLWVTGR |
| A0A3P8T6V7 | 249-302 | None |
| A0A0D2MUN9 | 22-73 | None |
| E9HVP9 | 159-206 | None |
| A0A821ZZJ2 | 223-273 | None |
| A0A5N5QBB5 | 748-798 | None |
| A0A7I8IZE3 | 379-431 | None |
| A0A7R9I6C1 | 162-212 | None |
| A0A7R9QIJ3 | 278-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.