DPCstruct | MC6095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 156 ± 29 aa |
| Standard deviation of domain lengths | 29.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166YKB6 | 1-186 | MALELYIPPCIKNPVHPHHPPPAEKPLRIQIEGPLVSIQKLVPKAKWHTDVFNHTFPQPAGPLLARLVFEKIFGRQAQPEKIVGDLV… |
| A0A319EY89 | 1-188 | MALPLYIPPCIHTPADKHHLPPPDQPLRIQIEGPLSAIQRLLPDTPWHLDWDFANPTFPQPAGPALAKLAYQQIYGRDVSTDIIPGD… |
| A0A1B8FJQ4 | 29-214 | None |
| A0A2N1LJ25 | 1-195 | None |
| A0A161YF08 | 1-108 | None |
| A0A093XZM4 | 29-204 | None |
| A0A6P8BEP1 | 42-194 | None |
| A0A084ASR2 | 1-166 | None |
| A0A179IA51 | 1-184 | None |
| G3JNG8 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.