DPCstruct | MC60947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 221 |
|---|---|
| Mean domain length (aa) | 192 ± 30 aa |
| Standard deviation of domain lengths | 30.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C2TBE9 | 3-139 | DLRAFTSKHRPTISEAASTALEVARDPRRAQEFVFVIFLRPRPNSTRVETAFFAFGAAVVPFSAFSPEQIAEMKGQLKSAHDLNVRN… |
| A0A5M3MKW8 | 24-223 | SKECQKATWPLHKLECRTLWGLARTRAGQISGNPNAWGEFTRWAEYHQTSLSNFSINGYIQYGPGSDEHYVFGIYLRYQKNHAELPL… |
| V2WYB9 | 808-975 | None |
| A0A146HGI5 | 161-361 | None |
| A0A146HLC4 | 327-527 | None |
| A0A146HV00 | 461-662 | None |
| A0A165XGZ6 | 37-236 | None |
| A0A165XN44 | 26-230 | None |
| A0A166D4U0 | 41-275 | None |
| A0A1S3G7Z3 | 307-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.