DPCstruct | MC60944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 280 ± 67 aa |
| Standard deviation of domain lengths | 67.06 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15394 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M3M7V4 | 20-273 | SPFKEPSVPEVVAFERRKEGGPTAKNFRLQLQKANASQWNKQAIRVFTKDFRGCSWHANAGYGKVKRTFEVHMQALREQYKVIKRKS… |
| A0A5C3MSH5 | 7-306 | HQKHVRRKFRKICGVTESAPWPHADEIRDGPAPGEDYYTPDFSVRSTHHVNQEIFDRVASLLMEELEDPNQREDELRHPSVYFNAQT… |
| A0A2N0QE51 | 21-220 | None |
| A0A146H4H9 | 251-574 | None |
| A0A2N0R1S2 | 5-202 | None |
| A0A2H3D3I4 | 224-534 | None |
| A0A6P8HX37 | 6-170 | None |
| A0A0D2Q080 | 780-1050 | None |
| A0A2I1EGN2 | 5-186 | None |
| A0A2I1ELT4 | 72-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.