DPCstruct | MC60940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5X4C4 | 97-183 | IYDKHKVRTKISDLSIPTLNSGKVVIELPPDELYNLGEFDTLEDYCRQDCNLTRGIYEYGLDNNSVYYEDRSKSIHMLDVDWEQYKA |
| A0A1G2CQH0 | 3-91 | IGRRISLDILAHTNVGFGKTSHGLEAVRFYREGLLKELESYCLNDVKVTKEVYDLARRQKYLLVPDRITGNNEKVELDFYEGEMIMK… |
| A0A7V5V682 | 234-326 | None |
| A0A1G2L5F2 | 94-179 | None |
| A0A534Q4C1 | 702-810 | None |
| A0A257V3C4 | 70-154 | None |
| A0A2H6HSX2 | 345-438 | None |
| A0A661QBR5 | 7-105 | None |
| K1ZFS7 | 44-135 | None |
| A0A350LZD3 | 85-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.