DPCstruct | MC6094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4I3W7 | 7-62 | IIQGLWIGGKLSIMEQLSISSFIKNGHEYHLYVYDEVKNIPAGTVIKDGNEILPSS |
| A0A0P1EAI2 | 4-53 | YQVGMLWIEGPLSFLEQLCTKSFLDVGQHVRLYTYGPVTNIPEGVEVRDA |
| A0A842I774 | 385-439 | None |
| A0A286E3C4 | 684-739 | None |
| A0A439QNM7 | 6-62 | None |
| A0A444MFS9 | 6-59 | None |
| A0A644U1F3 | 840-892 | None |
| A0A1M5U5K7 | 6-58 | None |
| A0A6L3B688 | 405-470 | None |
| A0A2G1CHR6 | 5-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.