DPCstruct | MC60936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 206 ± 35 aa |
| Standard deviation of domain lengths | 35.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0XGW2 | 18-237 | SIQAAYLTFQSNKPSAQRSIMLMIVPLLKYNLLWSITVFSQCCFLLQDLLMNADKLLRADRPCSCDLWLGLLAFHLALVQNPQDSLV… |
| A0A1D6EC66 | 50-248 | MLLVLFSKLDNFLAPNRPCHNSLWISLLAFHEALARKPCDPLIVATFALAFYLGGDMSLAVDIGKSINRQHDTGFRELLEPKVWTDK… |
| A0A5J5AP83 | 136-370 | None |
| A0A7J0GBG0 | 239-354 | None |
| A0A811MAN8 | 517-674 | None |
| A0A166BVD2 | 174-390 | None |
| A0A2P5XA84 | 34-254 | None |
| Q8GZ55 | 106-339 | None |
| A0A6A1VX62 | 57-216 | None |
| A0A6J5Y4C2 | 295-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.