DPCstruct | MC6093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7Q534 | 781-896 | RDWQEGDPSITALDALDVLRMAVGLDPSFGPAKAQNFIAADINGDGAVTALDALEVLRAAVGIDSAAAPRWVFFDAATDWDAMALSR… |
| A0A0P1E755 | 1-106 | MDALQVLRISVGLDPTWGPASPKNLIAADFNRDGSVNALDALSILQVAVGQPTAVRPEWVFIDSDADLSGITRTDVSYDTGANVVAV… |
| A0A315DE25 | 235-358 | None |
| A0A543K918 | 563-669 | None |
| Q3APD0 | 917-1018 | None |
| A0A7C9HBC4 | 980-1096 | None |
| A0A7Z0KYJ6 | 466-568 | None |
| A0A7Z0HXL7 | 874-982 | None |
| A0A2E0YI63 | 245-361 | None |
| A0A1X6Z330 | 224-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.