DPCstruct | MC60924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 401 |
|---|---|
| Mean domain length (aa) | 287 ± 67 aa |
| Standard deviation of domain lengths | 66.52 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 99.16 |
| Assigned Pfam label(s) | CL0125- PF02609- PF04487- CL0302- PF08997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257M8K3 | 17-290 | KDVARVHFCVPDVESQTTEAHLIAAGSTLTLADALEKGEIKNGFALVRPPGHHSMRVVHGNRGFCNINNMAIMVEYLRSKYGHKKIA… |
| A0A7J4EVI7 | 12-198 | HHDDIKDMHKIYEIASLSAGGAIKAAKISLDKPAFALIRPPGHHASPEHCWGFCYFNNIAIAVRRLMKDKIIERAVIVDFDLHFGDG… |
| A0A1I8HYH6 | 131-483 | None |
| A0A7Y4ZJX4 | 29-318 | None |
| A0A2I2YP27 | 53-278 | None |
| A0A061RA23 | 1-176 | None |
| A0A3P8WLF9 | 14-318 | None |
| A0A2B4SRE0 | 26-266 | None |
| A0A5S6QFF0 | 1-229 | None |
| E9G3W6 | 33-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.