DPCstruct | MC60918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 144 ± 14 aa |
| Standard deviation of domain lengths | 14.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 64.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167W0D7 | 1-129 | MNSWFGNPSLLLSPHGHSSHGSGEVGGYLSDHSDLNRGRSPRGRRGTSKPPEDPTDPALLRDIPSWLRSLRLHKYTENLKDLRWDEL… |
| A0A0E9NCR8 | 217-374 | EERYKGVPGGYYRSGMENEWAQVPTRTRFEVYAASKTDNHTPYTRPYQPSTTFTLAPTTTSIHMRVHPSLWRRHPRRDPPTHPTSVH… |
| R4XK54 | 342-471 | None |
| A0A1C7NNY5 | 481-625 | None |
| A0A1X2GV92 | 170-325 | None |
| A0A286UB66 | 1-163 | None |
| A0A1X0RHF0 | 225-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.