DPCstruct | MC6091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 135 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.36 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF06032- PF20906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662VZX4 | 1-130 | MGIPIVDADGMGRAFPELQMTTFHVFGISITPMAISDEKGNTIFVDSINNEYGEWFARGVTRLMGGYSWISCYAMTGKELKKAAIKN… |
| A0A661X663 | 121-251 | IPVELGGYNTAVSLYLAAQKNLPVLDGDLTGRSAPEIRQTSYFLGGIPPTPAAVTTIFDEKIFLQDVTDYLRFDSILRLLVENSYQF… |
| K6WBL4 | 546-680 | None |
| A0A0G2FAN0 | 336-468 | None |
| R8BAL9 | 288-428 | None |
| A0A533SQ90 | 114-243 | None |
| A0A1K1XBV3 | 1-127 | None |
| A0A2B4RAA9 | 581-715 | None |
| A0A381I9J5 | 119-243 | None |
| A0A1S3J657 | 776-911 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.