DPCstruct | MC60904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452DNC9 | 2-58 | WFEVLPGIAFMGVGLFSNGGEEKRVAHYSYQWYLMERDRRVSGVNHDYVSKSLENTD |
| A0A665UXV4 | 3-64 | YEILPGFAIMTACLIIPGVATAQIHKFTNGGKEKRIARVPWQWYLMERDRRLGGQHHNSKGL |
| A0A3B3Q503 | 1-66 | None |
| A0A4W3J248 | 33-99 | None |
| A0A6P6DC21 | 23-86 | None |
| A0A670HWS6 | 2-70 | None |
| A0A2G9SDC7 | 1-68 | None |
| A0A671EMU3 | 82-148 | None |
| A0A3Q1EYG8 | 1-70 | None |
| A0A6P6E5Z9 | 15-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.