DPCstruct | MC6090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 157 ± 26 aa |
| Standard deviation of domain lengths | 25.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841JIH7 | 2-124 | LSNILKHYGYPGYDLVGEKGSNAFWLMAQHSDYDPALQERILAAMKPELTKHNADPKNFAYLTDRVRLNTGRKQLYGTQVTYRNDSC… |
| A0A660PVI8 | 15-173 | ERPYSKADKTSPVSDRLAEMVTADQRLRSDDTLDYGIVAETDRLHREVVFELLAEGAITEATDLHRAALILQHADPSSCRECYFLAY… |
| J1KXQ6 | 19-183 | None |
| A0A2X1ARB7 | 2-133 | None |
| A0A357N1C1 | 54-219 | None |
| A0A495DMP0 | 165-316 | None |
| A0A1M7LFA4 | 30-205 | None |
| A0A7H5ESU0 | 242-433 | None |
| A0A5F0AY31 | 4-132 | None |
| A0A7S2AXH4 | 112-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.