DPCstruct | MC609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0BTF4 | 1-72 | MIGLVRDFRGQRYEVVEKSERTRRDGTLAIILHWESMCADCGEPFRLTTPAASSKFEPNRRCQKHKRPGQRV |
| A0A7M2XCZ0 | 8-83 | TLSGVAPVGLSIEVNGQRFDLIGHEPYLTKDGATTTLMLWQAECATCGEGFTTTAAPNRWPERRRCDLHTRPGKAV |
| A0A0S4Q109 | 11-87 | None |
| A0A2J0YVC5 | 1-78 | None |
| A0A1X3GRG4 | 1-90 | None |
| A0A1M5M778 | 2-76 | None |
| H8FTW0 | 64-142 | None |
| A0A4Q5L533 | 6-82 | None |
| A0A1M3C073 | 8-75 | None |
| A0A0L6CR37 | 68-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.