DPCstruct | MC60899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 126 ± 18 aa |
| Standard deviation of domain lengths | 17.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03745 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1PBZ4 | 45-170 | GEPTTRCQEPPSPALLQGIAQFNRGEFFEQHETLEEAWIEEDDSIRYLYQGILQIGVGFYHLLRGNPRGAAGMWAKGVRLLESFPPR… |
| A0A2D9Q414 | 3-128 | TRTAHPLSDEEHELLEAGATLFDAGKFWHAHEAWEDLWNDLKRRRASDHEILLVQGMIQTAALLLHHQRKNVGGVEKQWAKLTPKLE… |
| A0A849TIH0 | 1-177 | None |
| A0A517ZIB3 | 6-127 | None |
| A0A0P1F7P8 | 14-152 | None |
| A0A2V7I964 | 157-272 | None |
| A0A3C1P0W2 | 2-135 | None |
| A0A2V5QCM9 | 20-157 | None |
| A0A6C0G8B2 | 3-119 | None |
| A0A5P2A1M7 | 8-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.