DPCstruct | MC60892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 128 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838WY84 | 3-121 | VSETLDGFAPQATPDDAEFYLTGEHIFPFQFDEDPALRPFKEVAEELARNDDWRNLYAGLGASTSAAAVVYTDDIFVPRELSLETAD… |
| A0A2T0Y6L6 | 310-434 | WAAQRVRDGDPDFAVDARPLLFTGEMIYPWMFDQVAALRPFRAAAEALAARDDWRDLYDLDVLAANEVPLEAAVYHDDMFVDAGLSL… |
| A0A0P0WTC2 | 1-99 | None |
| A0A812K3M8 | 427-545 | None |
| A0A4U0XIV9 | 319-441 | None |
| A0A7Y6CG33 | 65-171 | None |
| A0A6V7NUK6 | 20-141 | None |
| A0A7S1XQE7 | 478-653 | None |
| A0A146I8Y3 | 307-444 | None |
| A0A1E7FRX1 | 289-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.