DPCstruct | MC6088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660PCQ5 | 12-81 | DTVTAIQIAETIWLSVYGKSIYERKPFKAELIGDTLWIVAGCMPNNMLGGVPYIEIQKKDGKVLGLGHGK |
| A0A2N9MYG7 | 2-75 | KIAEKALAKVYGEKKIESERPFKAILRDGIWHVGGTLYCNDEHGNVITGRCVGGVAMADIRQRDGRVLKTGHTK |
| A0A1K1SEK4 | 155-232 | None |
| A0A3D1GWX3 | 58-138 | None |
| A0A7X4MGN7 | 1-66 | None |
| A0A255U342 | 232-304 | None |
| A0A1M7J9D6 | 31-112 | None |
| A0A562SDE3 | 160-231 | None |
| A0A848ATS9 | 232-307 | None |
| A0A7L4ZZE5 | 27-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.