DPCstruct | MC60876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 168 ± 32 aa |
| Standard deviation of domain lengths | 31.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4V3D7 | 2-151 | MGIYDTVSALSVNLPWFAQILPDNYSFHNHRISDCVLAGYHALTLDETRAAYAPERWEADETGAPHEMEQVWFSGSHADVGGHLLGH… |
| A0A7X3Q5H5 | 1-122 | KYGYHAVSIDEQRKKFPANMWSEDARADHQTIEQVWFAGVHSDVGGWYREAGLSDIALDWMLNKAQAQGLRLRPGWQRRLSPDPAGR… |
| A0A7Y2TW96 | 31-197 | None |
| A0A2A9KI50 | 213-341 | None |
| A0A7T8XX74 | 181-355 | None |
| A0A3N4IFN3 | 153-385 | None |
| A0A1L9WUU4 | 25-204 | None |
| A0A2E4H5W6 | 5-158 | None |
| A0A7C1PWT8 | 130-319 | None |
| A0A194V4Y5 | 73-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.