DPCstruct | MC60873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.64 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0258- CL0342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8EZ81 | 502-624 | MIFINHLARQDVRPKNVVETFVLLLSPFAPHIAEELWQRLGHTDTLAYAPWPTYDPALCRAKEVELAVQVHGKIKDKIVVPAEADEE… |
| A0A7W0QIM9 | 1-61 | DVIELPVQVNGKVRARITVAADADDETVTSAALADEKVMATIDGATPRKVIVVPGRMVNVV |
| A0A1B0C1R2 | 513-640 | None |
| A0A7K3DI87 | 657-773 | None |
| A0A7V5G9Y3 | 131-249 | None |
| H0ECA0 | 448-586 | None |
| A0A378N0L5 | 44-172 | None |
| A0A519SMC1 | 257-375 | None |
| W3XZP1 | 95-222 | None |
| A0A7Y2YEV6 | 153-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.