DPCstruct | MC60872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 180 ± 33 aa |
| Standard deviation of domain lengths | 32.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1ZH10 | 117-274 | KKLKDLCLAPFLKDAKTKTLKVNARYDLSINELVKASKQDYVNPDITDQHFPTKKCPATKKEMVLLHLNKNVSAKVTMMVMKQLKLR… |
| A0A1F6N9L9 | 149-357 | KQFFGPEMQFVSAAEFEARATALLGQVGDHKQVKNLRRGVYLPFSLPKLVVADYGRTLKEIFLAAVERSYRAQFPNRPFVNCRKGQL… |
| A0A285E186 | 8-175 | None |
| A0A1F6URG3 | 2-177 | None |
| A0A2D6L8G1 | 6-155 | None |
| A0A1F5Q9I1 | 1-202 | None |
| A0A1G2HZ82 | 27-206 | None |
| A0A1G2I0P7 | 73-261 | None |
| A0A7T9BTA2 | 7-164 | None |
| A0A7T5RJS6 | 27-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.