DPCstruct | MC60871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 203 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0QH72 | 79-288 | HHLGELVGTRRESRKVDIREVTGLANSPCSVHSFPSMLVFAHQHCRRIPHSTDADFANNARHVFRYADQANVFRAYDFAGGELFYMN… |
| A0A1A9KMK6 | 3-197 | ESWECEIQDVQGLCASKSELRDFESLDAMAVARTQYLVGEITHANLEKSLGWYEIRILHRDSTDDFFACHQWDGRVFLMNSGGSHHF… |
| A0A0S7ZU88 | 77-279 | None |
| A0A2W5HQH8 | 26-226 | None |
| A0A1Z3CGD9 | 160-356 | None |
| W9T9K8 | 66-273 | None |
| A0A2P5MI19 | 26-236 | None |
| A0A2V3CQ14 | 70-297 | None |
| W3Y9C4 | 2-179 | None |
| A0A7L9EVN1 | 153-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.