DPCstruct | MC6087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 3.13 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151EZ84 | 48-115 | MVKQDVLILTGRNDHFIPFKMHDKQVKALTNAKSVTARVFTKEEQAHNHCQIGNIGLALDVMVKWIEK |
| A0A1G4TGN0 | 2-65 | INQDVLLLAGEEDQYVPISRLPQIQQELCNAATITTKVFTRETGGEQHCQAGHRHLAFNEMKKF |
| A0A3S4XAY7 | 93-162 | None |
| A0A645JDC5 | 36-98 | None |
| A0A2N2WHE3 | 129-199 | None |
| A0A7G9FH10 | 9-78 | None |
| R7KNB7 | 71-141 | None |
| A0A1Y3N882 | 25-92 | None |
| A0A2N2JXM4 | 591-654 | None |
| W4NAR8 | 42-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.