DPCstruct | MC60866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 126 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0123- PF03592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5JV95 | 6-127 | VRKSDEIVDAILLRISDGESLRTICKTRGMPHRVTFLRWVNDDEKLQKLYTDALKWREQIYFDDLIGIADECKDPAKARVMSDNRKW… |
| A0A524QNQ1 | 2-129 | KICNRIAGGESLVGILKFAGMPSRSMVMRWLHKHDEFRDLYAIARQAQAEMYANEIISIADEDPVMVMDIKSVGGRDVEVLRVDSAA… |
| A0A1H8XYU4 | 2-98 | None |
| A0A1H8XSD7 | 28-141 | None |
| A0A3D3GJ52 | 78-208 | None |
| A0A0M4KX43 | 1-138 | None |
| A0A844RVZ8 | 7-138 | None |
| A0A2T7SQ67 | 42-136 | None |
| A0A1I5E4B1 | 13-165 | None |
| A0A3S0DG67 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.