DPCstruct | MC60862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 122 ± 24 aa |
| Standard deviation of domain lengths | 24.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A431I6V2 | 8-133 | EAGAGGSPGSDAAAPPAPAPAPAPAEDAVASAVRALLVQARSQYAGMRYTQPPDDNALQTWRQVLKLAPGNAEALAGIAGIRARFIG… |
| A0A7H9CQ26 | 22-130 | ALQRLLDARIAGFLERAEQSIADKRLLLPEEDSAVYYYQQILGWAPGNEQALAGLNRVAMLYRDLANASYRRSDFPAALAMIERGLQ… |
| A0A2D6DIL1 | 115-263 | None |
| A0A7W8K2I5 | 126-290 | None |
| A0A2W1MEZ9 | 79-189 | None |
| A0A257B0Z4 | 131-242 | None |
| A0A1X7AJ53 | 28-165 | None |
| A0A501X257 | 60-197 | None |
| A0A2N9YHV4 | 301-428 | None |
| A0A3D0ZUF1 | 49-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.