DPCstruct | MC6086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 160 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9XBI9 | 258-416 | PDALARFTVDGQDYVLSANEGDSRAYDALDEEVRTKELTLDPQVFPDAALQDDEQLGRLTVTTVNGDLGNDGDHEQLYAFGTRSVSV… |
| A0A5Q0EI55 | 939-1099 | PDAVVGFSVAGTDYYLFANEGDSRDYDGFSEEARVKDLTLDPTRFADAASLQADDQLGRLQVSTEGGADSDGDGDIDQLLAYGGRSI… |
| W4QD95 | 155-309 | None |
| A0A7V9GGT9 | 311-473 | None |
| A0A5J4Z7D3 | 796-934 | None |
| A0A562IYX1 | 265-418 | None |
| B3QMS6 | 397-539 | None |
| A0A376CJC4 | 108-278 | None |
| A0A330MS17 | 586-751 | None |
| A0A1W1UYS0 | 57-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.