DPCstruct | MC60859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 138 ± 30 aa |
| Standard deviation of domain lengths | 29.50 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523GGZ6 | 11-123 | NMPRFKINTEPNLNIFAINTRLFYEMLDYLSEKELVVILTKLPMYKTYHAKKNPGILRRRDSVIADVLQKYRNVKLLDLETDTVLFQ… |
| A7M5W9 | 27-144 | SQFGLKDTLTDEITDTLADKFKQTSKILEGMIDFCISQGLRPILVCTPISHHMNLRLSDRFLDKVLFSNIRNANKANIPFLDYTRDA… |
| A0A395V9X9 | 326-439 | None |
| A0A2S6H9K0 | 431-545 | None |
| A0A3C0PHG1 | 838-1008 | None |
| A0A1V0RGG7 | 2-116 | None |
| A0A6V8CHD8 | 1-108 | None |
| A0A2A3HH52 | 521-694 | None |
| A0A496AMQ2 | 384-560 | None |
| A0A352SYA3 | 445-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.